Font Categories

Download Malik Sans Serif Family font - MalikTrial-Bold.ttf by Zetafonts

(0 vote)
Download free Malik Sans Serif Family font by Zetafonts free for Personal Use. Font list: MalikTrial-Bold.ttf, MalikTrial-BoldItalic.ttf, MalikTrial-Book.ttf, MalikTrial-BookItalic.ttf, MalikTrial-Extrabold.ttf, MalikTrial-ExtraboldItalic.ttf, MalikTrial-Extralight.ttf, MalikTrial-ExtralightItalic.ttf, MalikTrial-HeavyDisplay.ttf, MalikTrial-HeavyDisplayItalic.ttf, MalikTrial-Italic.ttf, MalikTrial-Light.ttf, MalikTrial-LightItalic.ttf, MalikTrial-Medium.ttf, MalikTrial-MediumItalic.ttf, MalikTrial-Regular.ttf,
  • Malik Sans Serif Family font
  • Malik Sans Serif Family font
  • Malik Sans Serif Family font
  • Malik Sans Serif Family font

About Malik Sans Serif Family font

Malik Sans Serif Font is a friendly geometric sans serif font family, reduced to its essential attributes. Taking its name from the arabic word for “king”, Malik is a flared sans serif typeface family designed in 2020 by Andrea Tartarelli. The designer wanted to find a way to bridge the classical letterforms of Roman Old Style typefaces with the readability of contemporary sans typefaces. This was achieved by using the so-called flared serif that emerges gradually from the stem of the letter, ending in a sharp angle. It’s something that also reminds of the peculiar shapes of the Simoncini Method, invented by Italian type designer Francesco Simoncini to get a sharper definition of letterforms. To this blend of classical elegance and modernist expertise, Malik adds the calligraphic influence of modern masters like Frederic Goudy or Ed Benguiat, visible in signature details like the reverse contrast uppercase B, or the calligraphic lowercase k.

Malik also means “owner”, and this font surely wants to rule the page. It manages to be extremely readable when used in body text size, but looks surprising and expressive in display use. The inclusion of the Malik Heavy Display weight, with its black texture balanced by deep inktraps, allows for striking logo design. The weight range of the family is extremely wide, including a Book alternative to the Regular weight for fine-tuning readability, a range of light display weights and a solid choice of bold weights for branding, all coming with matching true italics. The 16 cuts of Malik have been equipped with all the features you need to solve your editorial and design challenges, including a wide language coverage (thanks to over one thousand latin and cyrillic characters) and a complete set of open type features (including small capitals, positional numbers, case sensitive forms). Alternate characters and stylistic sets allow you to fine-tune your editorial and branding design by choosing variant letter shapes.

This is the demo version. Malik Sans Serif Font free for personal use. For full version and commercial purposes, please visit here

Download font

Free for Personal Use

This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.

AA Aa aa
  • Malik Trial Bold | MalikTrial-Bold.ttf
    Malik Trial Bold font - MalikTrial-Bold.ttf
  • Malik Trial Bold Italic | MalikTrial-BoldItalic.ttf
    Malik Trial Bold Italic font - MalikTrial-BoldItalic.ttf
  • Malik Trial Book | MalikTrial-Book.ttf
    Malik Trial Book font - MalikTrial-Book.ttf
  • Malik Trial Book Italic | MalikTrial-BookItalic.ttf
    Malik Trial Book Italic font - MalikTrial-BookItalic.ttf
  • Malik Trial Extrabold | MalikTrial-Extrabold.ttf
    Malik Trial Extrabold font - MalikTrial-Extrabold.ttf
  • Malik Trial Extrabold Italic | MalikTrial-ExtraboldItalic.ttf
    Malik Trial Extrabold Italic font - MalikTrial-ExtraboldItalic.ttf
  • Malik Trial Extralight | MalikTrial-Extralight.ttf
    Malik Trial Extralight font - MalikTrial-Extralight.ttf
  • Malik Trial Extralight Italic | MalikTrial-ExtralightItalic.ttf
    Malik Trial Extralight Italic font - MalikTrial-ExtralightItalic.ttf
  • Malik Trial Heavy Display | MalikTrial-HeavyDisplay.ttf
    Malik Trial Heavy Display font - MalikTrial-HeavyDisplay.ttf
  • Malik Trial Heavy Display Italic | MalikTrial-HeavyDisplayItalic.ttf
    Malik Trial Heavy Display Italic font - MalikTrial-HeavyDisplayItalic.ttf
  • Malik Trial Italic | MalikTrial-Italic.ttf
    Malik Trial Italic font - MalikTrial-Italic.ttf
  • Malik Trial Light | MalikTrial-Light.ttf
    Malik Trial Light font - MalikTrial-Light.ttf
  • Malik Trial Light Italic | MalikTrial-LightItalic.ttf
    Malik Trial Light Italic font - MalikTrial-LightItalic.ttf
  • Malik Trial Medium | MalikTrial-Medium.ttf
    Malik Trial Medium font - MalikTrial-Medium.ttf
  • Malik Trial Medium Italic | MalikTrial-MediumItalic.ttf
    Malik Trial Medium Italic font - MalikTrial-MediumItalic.ttf
  • Malik Trial Regular | MalikTrial-Regular.ttf
    Malik Trial Regular font - MalikTrial-Regular.ttf

Malik Trial Bold | MalikTrial-Bold.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Bold
  • Unique identifier: 1.000;UKWN;MalikTrial-Bold
  • Full font name: Malik Trial Bold
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Bold
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Bold Italic | MalikTrial-BoldItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Bold Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-BoldItalic
  • Full font name: Malik Trial Bold Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-BoldItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Book | MalikTrial-Book.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Book
  • Unique identifier: 1.000;UKWN;MalikTrial-Book
  • Full font name: Malik Trial Book
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Book
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Book Italic | MalikTrial-BookItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Book Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-BookItalic
  • Full font name: Malik Trial Book Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-BookItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Extrabold | MalikTrial-Extrabold.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Extrabold
  • Unique identifier: 1.000;UKWN;MalikTrial-Extrabold
  • Full font name: Malik Trial Extrabold
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Extrabold
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Extrabold Italic | MalikTrial-ExtraboldItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Extrabold Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-ExtraboldItalic
  • Full font name: Malik Trial Extrabold Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-ExtraboldItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Extralight | MalikTrial-Extralight.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Extralight
  • Unique identifier: 1.000;UKWN;MalikTrial-Extralight
  • Full font name: Malik Trial Extralight
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Extralight
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Extralight Italic | MalikTrial-ExtralightItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Extralight Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-ExtralightItalic
  • Full font name: Malik Trial Extralight Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-ExtralightItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Heavy Display | MalikTrial-HeavyDisplay.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Heavy Display
  • Unique identifier: 1.000;UKWN;MalikTrial-HeavyDisplay
  • Full font name: Malik Trial Heavy Display
  • Version: Version 1.000
  • Postscript font name: MalikTrial-HeavyDisplay
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Heavy Display Italic | MalikTrial-HeavyDisplayItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Heavy Display Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-HeavyDisplayItalic
  • Full font name: Malik Trial Heavy Display Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-HeavyDisplayItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Italic | MalikTrial-Italic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-Italic
  • Full font name: Malik Trial Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Italic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Light | MalikTrial-Light.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Light
  • Unique identifier: 1.000;UKWN;MalikTrial-Light
  • Full font name: Malik Trial Light
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Light
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Light Italic | MalikTrial-LightItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Light Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-LightItalic
  • Full font name: Malik Trial Light Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-LightItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Medium | MalikTrial-Medium.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Medium
  • Unique identifier: 1.000;UKWN;MalikTrial-Medium
  • Full font name: Malik Trial Medium
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Medium
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Medium Italic | MalikTrial-MediumItalic.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Medium Italic
  • Unique identifier: 1.000;UKWN;MalikTrial-MediumItalic
  • Full font name: Malik Trial Medium Italic
  • Version: Version 1.000
  • Postscript font name: MalikTrial-MediumItalic
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]

Malik Trial Regular | MalikTrial-Regular.ttf

  • Font family: Malik Trial
  • Font subfamily identification: Regular
  • Unique identifier: 1.000;UKWN;MalikTrial-Regular
  • Full font name: Malik Trial Regular
  • Version: Version 1.000
  • Postscript font name: MalikTrial-Regular
  • Manufacturer name: Zetafonts
  • Designer: Andrea Tartarelli
  • License: END USER LICENSE AGREEMENT By downloading and using this software you accept the terms of the following agreement ("EULA"): This licence is reserved to individuals and doesn't apply to corporate/studio entities. It allows one single person on unlimited cpus to use the font(s) for personal - not commercial uses. This license doesn't apply to broadcast and software embedding uses, and doesn't allow re-distribution in any form. For commercial uses, you have to purchase a commercial license from www.zetafonts.com. (more informations at www.zetafonts.com/licensing) Our End-User License Agreement ("EULA") grants you the following rights: 01] You may install and use an unlimited number of copies of the fonts. 02] You can make archival copies of the fonts for your own purposes. 03] A copy of the fonts may be sent as part of a file release to a prepress bureau. 04] Fonts can be embedded in other software files, such as Portable Document Format (PDF) or Flash files, but you will take all reasonable care to embed the fonts in such a way that they cannot be extracted from the files you create. 05] You may modify the fonts for your own purposes, but the copyright remains with Zetafonts, and you are not allowed to distribuite renamed, edited or derivative works, either for profit or not. 06] No reselling of the font as a font software is allowed: copies of the font installation files may not be distributed or shared in any way (for profit or free of charge) either on a standalone basis or included as part of your own product. (for use of the font on websites as webfonts or in applications as screen fonts, a software license is required) Zetafonts expressly disclaims any warranty for the fonts. The fonts and any related documentation is provided "as it is" without warranty of any kind, either express or implied, including, without limitation, the implied warranties or merchantability, fitness for a particular purpose, or noninfringement. The entire risk arising out of use or performance of the fonts remains with you. In no event shall Zetafonts or its suppliers be liable for any damages whatsoever (including, without limitation, damages for loss of business profits, business interruption, loss of business information, or any other pecuniary loss) arising out of the use of or inability to use this product, even if Zetafonts has been advised of the possibility of such damages. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply to you. This free for personal / non commercial use license is provided with free downloads of fonts. It allows unlimited use of the font(s) on all personal CPUs for non-commercial uses (i.e. no-profit projects, student work, pro-bono assignements). If you're an individual and plan to use our fonts for commercial projects, you should buy a personal commercial license. A company, studio or corporation that wants to make the fonts avalaible to many users should either buy a volume license (which is calculated as a discount on many single licenses) or a worldwide license.If you're using it for personal and non commercial use (school project, academic use, pro-bono work) you can download the font and use it freely. Please refer to www.zetafonts.com/licensing for information Feel free to contact us for further enquiries at [email protected]
#malik#sans#serif#family#malik sans#sans serif#serif family#family font#malik sans serif#sans serif family#serif family font#malik sans serif family#sans serif family font#malik sans serif family font#categories#font categories#serif fonts#sans serif fonts#maliktrial-boldttf#trial#malik trial#bold#trial bold#malik trial bold#maliktrial-bold#zetafonts#andrea#tartarelli#andrea tartarelli#maliktrial-bolditalicttf#italic#bold italic#trial bold italic#malik trial bold italic#maliktrial-bolditalic#maliktrial-bookttf#book#trial book#malik trial book#maliktrial-book#maliktrial-bookitalicttf#book italic#trial book italic#malik trial book italic#maliktrial-bookitalic#maliktrial-extraboldttf#extrabold#trial extrabold#malik trial extrabold#maliktrial-extrabold#maliktrial-extrabolditalicttf#extrabold italic#trial extrabold italic#malik trial extrabold italic#maliktrial-extrabolditalic#maliktrial-extralightttf#extralight#trial extralight#malik trial extralight#maliktrial-extralight#maliktrial-extralightitalicttf#extralight italic#trial extralight italic#malik trial extralight italic#maliktrial-extralightitalic#maliktrial-heavydisplayttf#heavy#display#heavy display#trial heavy#malik trial heavy#trial heavy display#malik trial heavy display#maliktrial-heavydisplay#maliktrial-heavydisplayitalicttf#display italic#heavy display italic#trial heavy display italic#malik trial heavy display italic#maliktrial-heavydisplayitalic#maliktrial-italicttf#trial italic#malik trial italic#maliktrial-italic#maliktrial-lightttf#light#trial light#malik trial light#maliktrial-light#maliktrial-lightitalicttf#light italic#trial light italic#malik trial light italic#maliktrial-lightitalic#maliktrial-mediumttf#medium#trial medium#malik trial medium#maliktrial-medium#maliktrial-mediumitalicttf#medium italic#trial medium italic#malik trial medium italic#maliktrial-mediumitalic#maliktrial-regularttf#regular#trial regular#malik trial regular#maliktrial-regular

More by Zetafonts

Comments (0)

no-avatar
Please login!

    Lastest update